(£) GBP (Default)
  • ($) USD
  • (€) EUR
  • ($) AUD
  • ($) CAD
  • ($) NZD

Kisspeptin Peptide Vial

Kisspeptin peptide vial is a hormone-secretion regulator that plays a role in sexual reproduction. The peptide’s effect on testosterone levels can affect sex-related behaviours like drive and motivation. In addition, some studies show that it may help slow or even reverse the ageing process.

£23.09£46.26

SKU PG: Kisspeptin vial Categories , ,

Description

Buy Kisspeptin Peptide Vial Greece

Kisspeptin Peptide Vial Greece is a hormone-secretion regulator that plays a role in sexual reproduction. The peptide’s effect on testosterone levels can affect sex-related behaviours like drive and motivation. In addition, some studies show that it may help slow or even reverse the ageing process. Greece Research has shown the peptide may help with male sex-related dysfunction and anxiety-related problems.

Lower Kisspeptin levels or function could cause significant problems. For example, infertility in both sexes may result from a malfunctioning hormone. However, when this occurs in females, it may result in additional hormonal disruption and the inability to ovulate.

Kisspeptin levels are lower in men with low sperm counts and infertility, according to studies. In contrast, the levels of Kisspeptin in fertile men were much higher than those in infertile men. There is also evidence that it assists males in regulating their testosterone, FSH, and LH levels.

Furthermore, this peptide is crucial in managing social and sex-related practices. In addition, research studies have revealed Kisspeptin is a hormonal agent usually connected with development throughout puberty and pregnancy.

In summary, nerve cells receptive to Kisspeptin have been found in a component of the mind called the amygdala – an area mainly managing sex-related and psychological practices, such as stress and anxiety or social communication.

Benefits of Kisspeptin Peptide Vial:

Scientific studies have suggested that the peptide could have the following benefits:

  • Men could see an increase testosterone levels
  • Increases mood and sexual desire
  • Reduces anxiety
  • Could have a positive effect for women undergoing IVF treatment

Amino Acid Sequence: GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF

Molecular Formula: C258H401N79O78

References:

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5702467/

https://jamanetwork.com/journals/jamanetworkopen/fullarticle/2800937

 

DISCLAIMER: We do not supply Peptides or Sarms to any individual under the age of 21. You must be a licensed and qualified healthcare practitioner. All products listed on this website (https://gre.pharmagrade.store) and provided through Pharma Grade are intended ONLY FOR medical research purposes. Pharma Grade Greece does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption) nor are the products intended as a drug, stimulant or for use in any food products.

Additional information

size

5mg vial, Kit: 5mg vial, syringes & bac water, 10mg vial, Kit: 10mg vial, syringes & bac water

Certificates

Kisspeptin_Pharmagrade HPLC Certificate

Disclaimer

We do not supply Peptides or Sarms to any individual under the age of 21. You must be a licensed and qualified healthcare practitioner. All products listed on this website (https://gre.pharmagrade.store) and provided through Pharma Grade are intended ONLY FOR medical research purposes. Pharma Grade does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption) nor are the products intended as a drug, stimulant or for use in any food products.